Encyclopedia > G > 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175

Glossary of psychiatry In this Glossary of Psychiatric Terms, initially mostly French and German and some English terms, as used in psychiatric literature, were defined. We have included many other terms with the passage of time and aim to broaden this article to include most of the psychopathological terms in use.
Glossary of semisimple groups This is a glossary for the terminology applied in the mathematical theories of semisimple Lie groups. It also covers terms related to their Lie algebras, their representation theory, and various geometric, algebraic and combinatorial structures that occur in connection with the development of what is a central theory of contemporary mathematics.
Glossary of terms in Hinduism The following is a glossary of terms and concepts in Hinduism. The list consists of concepts that are derived from both Hinduism and Hindu tradition, which are expressed as words in Sanskrit as well as other languages of India.
Glossary of terms in The Urantia Book The following glossary of terms in The Urantia Book provides short definitions of words and concepts presented in the book, especially those that are unique or defined in a way that differs from more traditional understandings. The glossary is meant to assist people unfamiliar with The Urantia Book who may come across conversations or writings having to do with the readership surrounding it.
Glossary of the French Revolution This is a glossary of the French Revolution. It generally does not explicate names of individual people or their political associations; those can be found in List of people associated with the French Revolution.
Glossary of the Weimar Republic These are terms, concepts and ideas that are useful to understanding the political situation in the Weimar Republic. Some are particular to the period and government, while others were just in common usage but have a bearing on the Weimar milieu and political maneuvering.
Glossator The scholars of the 11th and 12th century legal schools in Italy, France and Germany are identified as glossators in a specific sense. They studied Roman Law based on the Digestae, the Codex of Justinian, the Authenticae (an abridged Latin translation of selected Justinian's constitutions, promulgated in Greek after the enactment of the Codex and therefore called Novellae), and his law manual, the Institutiones Iustiniani, compiled together in the Corpus Juris Civilis.
Glossematics Glossematics is the rigorous study of language at the level of its most basic unit or component which carries meaning, the glosseme. The term was coined by Louis Hjelmslev and Hans Jørgen Uldall as a neologism combining glossary with mathematics to indicate a formalized system of study.
Glossolalia Glossolalia (from the Greek, "γλώσσα" (glossa), tongue and "λαλώ" (lalô), I speak) comprises unintelligible utterances, often as part of religious practice. Glossolalia is claimed by some to be an unknown mystical language; others claim that glossolalia is the speaking of an unlearned foreign language (see xenoglossia).
Glossop railway station Glossop railway station serves the town of Glossop in Derbyshire and is the main terminus at the Derbyshire end of the Manchester-Glossop Line. It was opened by the Sheffield, Ashton-Under-Lyne and Manchester Railway in 1845.
Glossop Road Baths Glossop Road Baths is a building in Sheffield which houses a swimming pool and turkish baths. An indoor swimming pool was opened on the site in 1836, and was significantly expanded in 1877 to include a second, larger, swimming pool , a hairdresser and a turkish bath suite.
Glossop, South Australia Glossop () is a small town in the Riverland region of South Australia. It was gazetted in 1921 as the town in a soldier settlement area after World War I and was named after Admiral Glossop, who had been in charge of the HMAS Sydney when it sank the SMS Emden in 1914.
Glossopharyngeal breathing Glossopharyngeal breathing (GPB, also called frog breathing) is a means of forcing extra air into the lungs to expand the chest and achieve a functional cough. The technique involves the use of the glottis to add to an inspiratory effort by gulping boluses of air into the lungs.
Glossopteridales Glossopteridales is an extinct order of plants belonging to Pteridospermatophyta, or Seed Ferns. They arose during the Permian on the southern continent of Gondwana, but dwindled to extinction by the end of the Triassic period.
Glossopteris Glossopteris (Greek glossa, meaning "tongue", because the leaves were tongue-shaped) is the largest and best-known genus of the extinct order of seed ferns known as Glossopteridales. Long considered a fern after its discovery in 1824, it was later assigned to the gymnosperms.
Glossy Black-Cockatoo The Glossy Black Cockatoo (Calyptorhynchus lathami) is the smallest member of the subfamily Calyptorhynchinae found in Australia. Glossy Black Cockatoos are predominantly black/dark brown with striking caudal red patches.
Glossy-mantled Manucode The Glossy-mantled Manucode, Manucodia ater is a medium-sized, up to 42cm long, glossed green, blue and purple black bird of paradise with red iris, black bill, long graduated tail and somewhat elongated upper breast and neck feathers. Both sexes are similar.
Glossyware Glossyware is a slang term referring to marketing materials produced on high-gloss bond paper. Typically, the content of this material provides an abstract description of a product often too vague to obtain a solid understanding of the product and often lacking any relevant substance or evidentiary facts.
Gloster Aircraft Company The Gloster Aircraft Company was a British aircraft manufacturer formed in 1917 as the Gloucestershire Aircraft Company Limited. In 1926 the name of the company was abbreviated to Gloster because customers outside of the United Kingdom found the original name too difficult to pronounce.
Gloster E.1/44 The Gloster E.1/44 was a single engined jet fighter design of the Second World War which came about because of low availability of jet engines but was not completed in prototype form until after the war and never entered production.
Gloster Gamecock The Gloster Gamecock was a fighter aircraft, a development of the Mk III Grebe. It differed from the Grebe primarily by way of its Bristol Jupiter engine, which replaced the unreliable Armstrong Siddeley Jaguar.
Gloster Gladiator The Gloster Gladiator was a British-built biplane fighter, used by the Royal Air Force and the Royal Navy (as well as a number of other air forces), during World War II. The aircraft had a top speed of around 257mph (414 km/h).
Gloster Hill The hill designated Hill 235 during the Korean War is remembered as Gloster Hill because of the actions of the Gloucestershire Regiment (the Glorious Glosters) in following their orders to "Hold on where you are" during the Battle of the Imjin River 1951.
Gloster Javelin The Gloster Javelin was an interceptor aircraft that served with Britain's Royal Air Force in the late 1950s and most of the 1960s. It was a large T-tailed delta-wing aircraft designed for night and bad weather operations.
Gloster Meteor The British Gloster Meteor was the first operational Allied jet fighter aircraft of the Second World War. It first flew in 1943 and commenced operations in mid-1944 in the Royal Air Force (RAF), nearly eight months after the Messerschmitt Me 262 entered service with the Luftwaffe as the world's first operational jet.
Glostrup station Glostrup station is a station on the Tåstrup radial of the S-train network in Copenhagen, Denmark. It is located close to the historical, administrative and commercial center of Glostrup municipality, but also serves Brøndbyvester in Brøndby municipality, whose boundary comes within a few hundred meters from the station.
Glottal consonant Glottal consonants are consonants articulated with the glottis. Many phoneticians consider them, or at least the so-called fricatives, to be transitional states of the glottis without a point of articulation as other consonants have; in fact, some do not consider them to be consonants at all.
Glottochronology Glottochronology is a method in linguistics used to estimate the rate at which languages change, based on the assumption that the basic vocabulary of a language changes at a roughly constant rate. This assumption, originally put forward by Morris Swadesh, is based on an analogy with the use of carbon dating for measuring the age of organic materials, in that a "lexical half-life" is estimated.
Gloucester and Sharpness Canal The Gloucester and Sharpness Canal is a canal in the south west of England, between Gloucester and Sharpness; for much of its length it runs close to the tidal River Severn, but cuts off a significant loop in the river, at a once-dangerous bend near Arlingham. It was once the broadest and deepest canal in the world.
Gloucester cattle Gloucester cattle were numerous in the Cotswold Hills and the Severn Valley of the United Kingdom as early as the 13th century. They were valued for their milk, producing Gloucester cheeses, for providing strong and docile draught oxen and, as a final product, for their beef.
Gloucester Cathedral Gloucester Cathedral, in Gloucester, England, stands in the north of the city near the river. It originated with the foundation of an abbey dedicated to Saint Peter in 681 (dissolved by King Henry VIII of England).
Gloucester City A.F.C. Gloucester City AFC are a semi-professional football club based in Gloucester, Gloucestershire, currently playing in the Southern League. Their current manager (appointed January 2006) is Tim Harris, who is an ex-goalkeeper and assistant manager at the club.
Gloucester City Public Schools Gloucester City Public Schools is a comprehensive community public school district that is based in Gloucester City, New Jersey, and serves students in kindergarten through twelfth grade. GCPS, an Abbott District, serves the city of Gloucester City.
Gloucester College, Oxford Gloucester College, Oxford was a Benedictine institution of the University of Oxford, from the late thirteenth century until the Dissolution of the monasteries in the sixteenth century. It was never a typical college of the University, in that there was an internal division in the College, by staircase units, into parts where the monasteries sending monks had effective authority.
Gloucester Eastgate railway station Gloucester Eastgate railway station was the station in Gloucester, England, used by trains from Birmingham to Bristol. Originally the Birmingham and Gloucester Railway (which later became part of the Midland Railway) used a terminus station roughly on the site of the current Gloucester station car park.
Gloucester High School (Virginia) Gloucester High School, a fully accredited high school located four miles from Gloucester Courthouse in Gloucester County, Virginia, was built in 1976. It was formerly located at the current Page Middle School, which houses sixth to eighth graders.
Gloucester House Gloucester House is a former royal residence in the seaside resort of Weymouth on the south coast of England. It was the summer residence of Prince William Henry Duke of Gloucester and Edinburgh (1743-1805), fourth son of Frederick, Prince of Wales and brother of King George III.
Gloucester Maritime Heritage Center The Gloucester Maritime Heritage Center is a non-profit grassroots organization located in Gloucester, Massachusetts, USA. It which started in 1999 when nearly three hundred people joined together to purchase the Harbor Loop site of the Gloucester Marine Railways.
Gloucester Northern Senior League The Gloucester Northern Senior League is a football competition based in England. It consist of two divisions, Division One and Division Two, with Division One sitting at level 12 of the English football league system.
Gloucester railway station Gloucester railway station (formerly known as Gloucester Central station) serves the city of Gloucester. The station is unusual as it is located off the main Bristol-Birmingham line, meaning trains that call at Gloucester usually have to reverse.
Gloucester Road, Hong Kong Gloucester Road (Chinese: 告士打道, Pinyin: Gāoshìdǎ dào) is a major road in the north of Wan Chai and East Point on the Hong Kong Island of Hong Kong. It connects to Harcourt Road at its western end and it ends east along west side of Victoria Park.
Gloucester Road, London Gloucester Road (B325) (pronounced ) is a street in the Royal Borough of Kensington and Chelsea of London. It runs north-south between Kensington Road (at which point it is known as Palace Gate) and Old Brompton Road at the south end.
Gloucester to Newport Line The Gloucester to Newport Line is a railway cutoff along the bank of the River Severn in the United Kingdom from Gloucester to Newport. It is an important link between the West Midlands and South Wales, and was formerly the main route from London before the construction of the Severn Tunnel.
Gloucester Township Public Schools The Gloucester Township Public Schools is a community public school district serving students in kindergarten through eighth grade from Gloucester Township, in Camden County, New Jersey, United States. The district has an enrollment of approximately 7,852 students attending, and is comprised of eight elementary schools (grades K-5), and three middle schools (grades 6-8), including the new Ann A.
Gloucester, Ontario Gloucester was a city in eastern Ontario, Canada on the Ottawa River and is now a suburb of the City of Ottawa. Gloucester Township was established in 1792 and originally included lands east of the Rideau River from the Ottawa River south to Manotick.
Gloucestershire Gloucestershire (pronounced ; GLOSS-ter-sher) is a county in South West England. The county comprises part of the Cotswold Hills, part of the flat fertile valley of the River Severn, and the entire Forest of Dean.
Gloucestershire Constabulary Gloucestershire Constabulary is the Home Office police force responsible for policing the non-metropolitan county of Gloucestershire in England. (South Gloucestershire is covered by Avon and Somerset Constabulary).
Gloucestershire County Cricket Club Gloucestershire County Cricket Club is one of the 18 major county clubs which make up the English domestic cricket structure, representing the historic county of Gloucestershire. Its limited overs team is called the Gloucestershire Gladiators.
Gloucestershire County Cricket Club in 2004 Gloucestershire County Cricket Club in 2004 were playing their cricket in Division One of the County Championship and totesport league. Despite finishing in mid-table positions in the leagues Gloucestershire won the Cheltenham and Gloucester Trophy, beating Worcestershire by eight wickets in the final at Lord's
Gloucestershire County Cricket Club in 2005 Gloucestershire County Cricket Club in 2005 are playing their cricket in Division One of both the County Championship and totesport League. They started the Championship at 18-1 to win it, and as one of the teams most likely to be relegated from it.
Glounthaune railway station Glounthaune railway station serves the town of Glounthaune in County Cork. After the reopening of the line to Midleton in 2008, it will provide the junction where the Midleton branch separates from the Cobh branch of Cork Suburban Rail.
Glove compartment A glove compartment or glovebox is a compartment built into the dashboard, located over the front-seat passenger's footwell in an automobile, often used for miscellaneous storage. The name derives from the original purpose of the compartment: to store gloves.
Glove on Fight Glove on Fight is a doujin boxing video game, released in 2002 by Watanabe Seisakujo (now French-Bread). The game features characters from various sources, including anime, dating sims, other doujin, and a company mascot.
Glove puppetry Glove puppetry (POJ: pò·-tē-hì; ), also known as budai mu'ouxi, shoucao kuileixi, shoudai kuileixi, chang-chung hsi (pinyin: zhǎngzhōngxì), xiaolong, or zhihuaxi is a type of local opera using cloth puppets that originated during the 17th century in Quanzhou or Zhangzhou, in China's Fujian province, and has been historically practiced in Quanzhou, Zhongzhou, Chaozhou in Guangdong, Taiwan, and other parts of southern China. The puppet's head uses wood carved into the shape of a hollow human head, but aside from the head, palms, and feet, which are made of wood, the puppet's torso and limbs consist entirely of cloth costumes.
Glovebox A glovebox, also called a glove box, is a sealed container that is designed to allow one to manipulate objects while being in a different atmosphere from the object. Built into the sides of the glovebox are two gloves arranged in such a way that one can place their hands into the gloves and be able to perform tasks inside the box without breaking the seal or allowing potential damage to a worker's hands.
Glover River The Glover River is a tributary of the Little River, 30 mi (48 km) long, in the Ouachita Mountains of southeastern Oklahoma in the United States. Via the Little and Red Rivers, it is part of the watershed of the Mississippi River.
Gloves (hockey) Hockey gloves are pieces of equipment used in ice hockey, or roller hockey used to protect the players hands from the ball or a hockey stick in roller hockey and they are used as protection from the puck or a hockey stick in ice hockey. The goalie uses a different glove, a baseball-like glove with a mesh, with indefinitely more protection.
Glow fuel Glow fuel is a generic term used to describe a fuel source used by models -- generally the same or similar fuels can be used in model airplanes, helicopters, cars and boats. Glow fuel can be burned by very simple two stroke engines or by more complicated four stroke engines and these engines can provide impressive amounts of power for their very small size.
Glowing plate When a vacuum tube circuit malfunctions and draws excessive current, the anode ("plate") may overheat, sometimes causing a visible red or orange glow. In consumer electronics, this is universally indicative that the tube is experiencing an overload condition, though the reasons for the overload may vary.
Glowsticking Glowsticking is simply defined as the art of dancing with glowsticks or other glowstick-like instruments that share the same kind of qualities: durable, consistency in light, safe to toss around, and often made up of a soft and pliant plastic.
Glowworm Glowworm (or glow-worm) is the common name for various different groups of insect larvae and adult larviform females which glow through bioluminescence. They may sometimes resemble worms, but all are insects (Arachnocampa being a fly and all the others being beetles).
Gloxinia (genus) Gloxinia is a genus of 3 species of tropical rhizomatous herbs in the flowering plant family Gesneriaceae. The species are primarily found in the Andes of South America but Gloxinia perennis is also found in Central America and the West Indies, where it has probably escaped from cultivation.
Glucagon receptor The glucagon receptor is a 62 kDa peptide that is activated by glucagon and is a member of the g-protein coupled family of receptors. Stimulation of the receptor results in activation of adenylate cyclase and increased levels of intracellular cAMP.
Glucagon rescue Glucagon rescue is the emergency injection of glucagon to an unconscious person due to severe cases of diabetic hypoglycemia. In this case, glucagon rescue preserves brain cells and may be a life saving measure.
Glucagon-like peptide-2 Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1).
Gluck (Hannah Gluckstein) Gluck (Hannah Gluckstein, August 13, 1895 - January 10, 1978) was a British painter. She was born into a wealthy Jewish family whom she scandalized by wearing men's clothes and running away to live with another woman.
Glucocerebrosidase Glucocerebrosidase (also called glucosylceramidase or D-glucosyl-N-acylsphingosine glucohydrolase) is an enzyme () that is needed to break down the chemical glucocerebroside by hydrolysis. It is localized in the lysosome and has a molecular weight of 59700 Da.
Glucocerebroside Glucocerebroside (also called glucosylceramide) is any of the cerebrosides in which the monosaccharide head group is glucose. They occur mostly in nonneuronal tissue and accumulate abnormally in Gaucher disease, where glucocerebrosidase is absent or nonfunctional.
Glucocorticoid Glucocorticoids are a class of steroid hormones characterised by an ability to bind with the cortisol receptor and trigger similar effects. Glucocorticoids are distinguished from mineralocorticoids and sex steroids by the specific receptors, target cells, and effects.
Glucocorticoid receptor The glucocorticoid receptor (GR) or nuclear receptor subfamily 3, group C, member 1 is a ligand-activated intracytoplasmatic transcription factor that interacts with high affinity to cortisol and other glucocorticoids.
Glucokinase regulatory protein The glucokinase regulatory protein (GKRP) is a protein produced in hepatocytes (liver cells) to bind glucokinase (GK), thereby controlling both activity and intracellular location of this key enzyme of glucose metabolism. One of the important functions of GKRP is to maintain a reserve supply of GK in the nuclei for rapid release into the cytoplasm as the glucose begins to rise during a meal.
Glucomannan Glucomannan is a water-soluble polysaccharide composing 40% by dry weight of the roots or corm of the konjac plant. Glucomannan is a dietary fiber, and has been marketed as a treatment for constipation, obesity, high cholesterol, Acne vulgaris (source) and Type 2 diabetes.
Gluconic acid Gluconic acid is the carboxylic acid formed by the oxidation of the first carbon of glucose and has the chemical formula C6H12O7. When dissolved in water, it forms the gluconate ion C6H11O7−; the salts of gluconic acid are also known as gluconates.
Glucono delta-lactone Glucono delta-lactone (GDL) is a naturally-occurring food additive used as a sequestrant, an acidifier, or a curing, pickling, or leavening agent. It is a cyclic ester of D-gluconic acid with chemical formula 6106 and CAS number 90-80-2.
Glucosamine Glucosamine (C6H13NO5) is an amino sugar that is an important precursor in the biochemical synthesis of glycosylated proteins and lipids. Glucosamine is commonly used as a treatment for osteoarthritis, although its acceptance as a medical therapy varies.
Glucose 6-phosphatase Glucose 6-phosphatase is an enzyme in the glycogenolysis pathway that removes the phosphate from glucose 6-phosphate. Also is the last step in gluconeogenesis where the goal is to increase free glucose in the blood due to the body being in the catabolic state.
Glucose cycle The glucose cycle (also known as the hepatic futile cycle) occurs primarily in the liver and is the dynamic equilibrium between glucose and glucose 6-phosphate. This is important for maintaining a constant concentration of glucose in the blood stream.
Glucose meter A glucose meter (or glucometer) is a medical device for determining the approximate concentration of glucose in the blood. It is a key element of home blood glucose monitoring (HBGM) by people with diabetes mellitus or with proneness to hypoglycemia.
Glucose oxidase The glucose oxidase enzyme (GOx) () binds to beta-D-glucose (an isomer of the six carbon sugar, glucose) and aids in breaking the sugar down into its metabolites. GOx is a dimeric protein which catalyzes the oxidation of beta-D-glucose into D-glucono-1,5-lactone which then hydrolyzes to gluconic acid.
Glucose tolerance test A glucose tolerance test in medical practice is the administration of glucose to determine how quickly it is cleared from the blood. The test is usually used to test for diabetes, insulin resistance, and sometimes reactive hypoglycemia.
Glucose uptake Glucose uptake is the process by which glucose is transported into cells through active transport. Though some glucose does enter cells through passive diffusion, the process is too slow to allow for adequate control of blood glucose levels and energy utilization.
Glucose-dependent insulinotropic peptide Glucose-dependent insulinotropic peptide (GIP) is a member of the secretin family of hormones. GIP is derived from a 153-amino acid proprotein encoded by the GIP gene and circulates as a biologically active 42-amino acid peptide.
Glucuronic acid Glucuronic acid (from Greek γλυκερός - "sweet") is a carboxylic acid that has the structure of a glucose molecule that has had its sixth carbon atom (of six total) oxidized. Its formula is C6H10O7.
Glue code In programming, glue code is code that does not compute anything functional towards meeting the program's requirements, but instead serves solely to "glue together" different parts of code that would otherwise not be compatible. Glue code often appears in code written to let existing libraries or programs interoperate, such as in foreign function interfaces like the Java native interface.
Glue Gun (band) Glue Gun (formerly known as GlĂĽ Gun) is an American punk rock band that formed in Los Angeles, California in 1991 by The Grim's Bob Oedy, who is the lead singer and only constant member as of the band's reunion. To date, Glue Gun released two full-length studio albums before splitting up in 1996.
Glue logic In electronics, glue logic refers to the custom electronic circuitry needed to achieve compatible interfaces between two (or more) different off-the-shelf integrated circuits. This is often achieved with a few cheap 7400- or 4000-components, or, in complex cases, a CPLD or FPGA.
Glued laminated timber Glued laminated timber, also called glue-laminated beams or Glulam, is a structural timber product composed of several layers of dimensioned lumber glued together. By laminating several smaller pieces of wood, a single large, strong, structural member can be manufactured from smaller timber.
Gluepot Reserve Gluepot Reserve is a conservation reserve established by Birds Australia in 1997 by the purchase, through a public appeal, of the 500 square kilometre Gluepot Station, a pastoral lease in the semi-arid mallee region of South Australia. The decision to purchase Gluepot Station, Birds Australia's first reserve, was taken in order to protect its outstanding floral and faunal values, under threat because of an application by the lessee to burn the property to provide grazing for sheep.
Gluhareff Pressure Jet Gluhareff Pressure Jet (or tip jet) is a type of jet engine] that, like a [[Pulse jet, has no moving parts. It was invented by Eugene Gluhareff, a Russian engineer who envisaged it as a power plant for personal helicopters and compact aircraft (such as Microlights).
Glulam Beam Glulam Beams are APA EWS stress-rated engineered wood products comprised of wood laminations, or "lams," bonded together with strong, waterproof adhesives used for support structures and esthetic purposes.
Gluma Gluma Desensitizer is the most widely used product in the United States for the treatment of dental sensitivity. Its formula of 5% glutaraldehyde and 35% HEMA (hydroxyethyl methacrylate) in water is used to help control both hypersensitive dentin and reduce the incidence of post-operative sensitivity in restorative dentistry procedures.
Glushko (crater) Attached to the western rim of Olbers crater is the young impact crater named Glushko. This crater possesses a relatively high albedo and is the focus of a prominent ray system that extends in all directions across the nearby surface.
Gluster Gluster is a GNU clustering distribution aimed at commoditizing supercomputing and superstorage. Core of the Gluster provides a platform for developing clustering applications tailored for a specific tasks such as HPC Clustering, Storage Clustering, Enterprise Provisioning, Database Clustering etc.
Glutamate dehydrogenase Glutamate dehydrogenase is an enzyme, present in mitochondria of eukaryotes, as are some of the other enzymes required for urea synthesis, that converts glutamate to α-Ketoglutarate, and vice versa. Its cofactor for the glutamate to α-Ketoglutarate reaction, which produces ammonium as well, is NAD+.
Glutamate Dehydrogenase 1 GLUD1 (Glutamate dehydrogenase 1) is a mitochondrial matrix enzyme, with a key role in the nitrogen and glutamate (Glu) metabolism and the energy homeostasis. GLUD1 is expressed at high levels in liver, brain, pancreas and kidney, but not in muscle.
Glutamate receptor Glutamate is a neurotransmitter in nerve cells which binds to all glutamate receptors located on neuron membranes, and is an example of a transmembrane receptor. Glutamate is the most prominent neurotransmitter in the body, being present in over 50% of nervous tissue.
Glutamate transporter Glutamate transporters are neurotransmitter transporters that exist in the membranes of neurons and glial cells to remove excess amounts of the neurotransmitters glutamate and aspartate from the synapse. Glutamate is the main excitatory neurotransmitter in the central nervous system (CNS), so glutamate transporters are required in the CNS to modulate its functioning.
Glutaric acidemia type 2 Glutaric acidemia type 2 is an genetic disorder that is characterised by defects in the ability of the body to use proteins and fats for energy. Incompletely processed proteins and fats can build up, leading to a dangerous chemical imbalance called acidosis.
Glutathione Glutathione (GSH), whose IUPAC name is 2-amino-5-{[2-[(carboxymethyl)amino]- 1-(mercaptomethyl)-2-oxoethyl]amino}-5-oxopentanoic acid, is Îł-glutamylcysteinylglycine, a tripeptide. It contains an unusual peptide linkage between the amine group of cysteine and the carboxyl group of the glutamate side chain.
Glutathione peroxidase Glutathione peroxidase (, ) is the general name of an enzyme family with peroxidase activity whose main biological role is to protect the organism from oxidative damage. The biochemical function of glutathione peroxidase is to reduce lipid hydroperoxides to their corresponding alcohols and to reduce free hydrogen peroxide to water.
Information are taken from Wikipedia, the open encyclopedia, to which contribute many volunteers from around the whole world. Texts are available under the following conditions GNU Free Documentation License.

Encyklopedie (cz) Encyklopédia (sk) Enzyklopädie (de)


en